Biotyscience Inc
Tel 400-669-8850
E-mail info@biotyscience.com
QQ 499854788
82458988
Cat No | BSPA-0429 |
Type | Polyclonal Antibody |
Source | Rabbit |
Size | 50 ul |
Application | WB, IF, IHC |
Format | Liquid |
Concentration | Please refer to the vial lable for the specific concentration. |
Buffer | Supplied in PBS. |
Storage | Store at -20 degree. Avoid repeated freeze/thaw cycles. |
Synonyms | PPARG;CIMT1;GLM1;NR1C3;PPARG1;PPARG2;PPARgamma;peroxisome proliferator-activated receptor gamma |
Purification | Affinity purification |
Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications. |
Description | Sequence: LSVMEDHSHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASGFH |
Background | Peroxisome proliferator-activated receptor γ (PPARγ) is a member of the ligand-activated nuclear receptor superfamily and functions as a transcriptional activator. PPARγ is preferentially expressed in adipocytes as well as in vascular smooth muscle cells and macrophage. Besides its role in mediating adipogenesis and lipid metabolism, PPARγ also modulates insulin sensitivity, cell proliferation and inflammation. PPARγ transcriptional activity is inhibited by MAP kinase phosphorylation of PPARγ at Ser84. |